LOC_Os01g16240 MADQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK LOC_Os07g48780 LOC_Os03g20370 Os07g0687200 OsJ_001186 Calmodulin-1 Os01g0267900 CALM1_ORYSJ OsJ_010214 CAM1-1 CAM OsJ_024630 Calmodulin mediates the control of a large number of enzymes, ion channels and other proteins by Ca(2+). Among the enzymes to be stimulated by the calmodulin-Ca(2+) complex are a number of protein kinases and phosphatases. 149 Os03g0319300 P0011D01.22 OJ1150_E04.120-1 OJ1200_C08.124-1 CAM1